PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04221.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 191aa    MW: 22413.4 Da    PI: 7.366
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04221.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.9e-1175120550
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                              ++ +rk +NRe+A+rsR +K++++ee   k  +L+ eN++L++++ 
  Rsa1.0_04221.1_g00002.1  75 RKKKRKLSNRESAKRSRVKKQKYLEEMNIKLNQLKIENRDLQNQIG 120
                              6899*************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-1069120No hitNo description
SMARTSM003382.1E-1271135IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.64573136IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-1075125No hitNo description
PfamPF001704.9E-975122IPR004827Basic-leucine zipper domain
CDDcd147027.01E-1776127No hitNo description
PROSITE patternPS0003607893IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MMSTISPVFS CEPRQTTHVP AFETGFTPWD ISHLFSVFDS SMNLIPHSAH EYLSPDSVNL  60
YGPDAVPTDS YTDERKKKRK LSNRESAKRS RVKKQKYLEE MNIKLNQLKI ENRDLQNQIG  120
YVLHHFQRTE TENNRLRLEQ RMLHSTLLNI TQVLMLHQID RSSDCVTWPY DDSTRVTVQH  180
DPYVITDHII L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17380ERKKKRKL
27495RKKKRKLSNRESAKRSRVKKQK
37580KKKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013751226.11e-119PREDICTED: ocs element-binding factor 1-like
TrEMBLM4F4M51e-117M4F4M5_BRARP; Uncharacterized protein
STRINGBra036025.1-P1e-117(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.11e-68basic leucine-zipper 5